Recombinant Human NME2 protein, His&Myc-tagged
Cat.No. : | NME2-3279H |
Product Overview : | Recombinant Human NME2 protein(P22392)(2-152aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2-152aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.2 kDa |
AA Sequence : | ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | NME2 non-metastatic cells 2, protein (NM23B) expressed in [ Homo sapiens ] |
Official Symbol | NME2 |
Synonyms | NME2; non-metastatic cells 2, protein (NM23B) expressed in; nucleoside diphosphate kinase B; NM23 H2; NDP kinase B; c-myc transcription factor; histidine protein kinase NDKB; nucleotide diphosphate kinase B; c-myc purine-binding transcription factor PUF; non-metastatic cells 2, protein (NM23) expressed in; PUF; NDKB; NDPKB; NM23B; NDPK-B; NM23-H2; MGC2212; MGC111212; |
Gene ID | 4831 |
mRNA Refseq | NM_001018137 |
Protein Refseq | NP_001018147 |
MIM | 156491 |
UniProt ID | P22392 |
◆ Recombinant Proteins | ||
NME2-5926H | Recombinant Human NME2 Protein, GST-tagged | +Inquiry |
NME2-6572HF | Recombinant Full Length Human NME2 Protein, GST-tagged | +Inquiry |
NME2-3055R | Recombinant Rhesus monkey NME2 Protein, His-tagged | +Inquiry |
Nme2-4436M | Recombinant Mouse Nme2 Protein, Myc/DDK-tagged | +Inquiry |
NME2-3279H | Recombinant Human NME2 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NME2-3791HCL | Recombinant Human NME2 293 Cell Lysate | +Inquiry |
NME2-3790HCL | Recombinant Human NME2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NME2 Products
Required fields are marked with *
My Review for All NME2 Products
Required fields are marked with *
0
Inquiry Basket