Recombinant Full Length Human NME2 Protein, GST-tagged

Cat.No. : NME2-6572HF
Product Overview : Human NME2 full-length ORF ( AAH02476, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 152 amino acids
Description : Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of A (encoded by NME1) and B (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq
Molecular Mass : 42.46 kDa
AA Sequence : MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NME2 non-metastatic cells 2, protein (NM23B) expressed in [ Homo sapiens ]
Official Symbol NME2
Synonyms NME2; non-metastatic cells 2, protein (NM23B) expressed in; nucleoside diphosphate kinase B; NM23 H2; NDP kinase B; c-myc transcription factor; histidine protein kinase NDKB; nucleotide diphosphate kinase B; c-myc purine-binding transcription factor PUF; non-metastatic cells 2, protein (NM23) expressed in; PUF; NDKB; NDPKB; NM23B; NDPK-B; NM23-H2; MGC2212; MGC111212;
Gene ID 4831
mRNA Refseq NM_001018137
Protein Refseq NP_001018147
MIM 156491
UniProt ID P22392

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NME2 Products

Required fields are marked with *

My Review for All NME2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon