Recombinant Human NME2 Protein, GST-tagged

• Cat.No.: NME2-5926H
• Product Overview: Human NME2 full-length ORF ( AAH02476, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of A (encoded by NME1) and B (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq
• Molecular Mass: 42.46 kDa
• AA Sequence: MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NME2 non-metastatic cells 2, protein (NM23B) expressed in [ Homo sapiens ]
• Official Symbol: NME2
• Synonyms: NME2; non-metastatic cells 2, protein (NM23B) expressed in; nucleoside diphosphate kinase B; NM23 H2; NDP kinase B; c-myc transcription factor; histidine protein kinase NDKB; nucleotide diphosphate kinase B; c-myc purine-binding transcription factor PUF; non-metastatic cells 2, protein (NM23) expressed in; PUF; NDKB; NDPKB; NM23B; NDPK-B; NM23-H2; MGC2212; MGC111212
• Gene ID: 4831
• mRNA Refseq: NM_001018137
• Protein Refseq: NP_001018147
• MIM: 156491
• UniProt ID: P22392