Recombinant Human NKTR Protein, GST-tagged

• Cat.No.: NKTR-5895H
• Product Overview: Human NKTR partial ORF ( NP_005376.2, 888 a.a. - 984 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a membrane-anchored protein with a hydrophobic amino terminal domain and a cyclophilin-like PPIase domain. It is present on the surface of natural killer cells and facilitates their binding to targets. Its expression is regulated by IL2 activation of the cells. [provided by RefSeq
• Molecular Mass: 36.41 kDa
• AA Sequence: ESNSERDVTKNSKNDSHPSSDKEEGEATSDSESEVSEIHIKVKPTTKSSTNTSLPDDNGAWKSSKQRTSTSDSEGSCSNSENNRGKPQKHKHGSKEN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NKTR natural killer-tumor recognition sequence [ Homo sapiens ]
• Official Symbol: NKTR
• Synonyms: p104; NKTR; natural killer-tumor recognition sequence
• Gene ID: 4820
• mRNA Refseq: NM_005385
• Protein Refseq: NP_005376
• MIM: 161565
• UniProt ID: P30414