Recombinant Human NKTR Protein (10-175 aa), His-SUMO-tagged

• Cat.No.: NKTR-686H
• Product Overview: Recombinant Human NKTR Protein (10-175 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cancer. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 10-175 aa
• Description: Component of a putative tumor-recognition complex. Involved in the function of NK cells.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 34.4 kDa
• AA Sequence: HFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: NKTR natural killer-tumor recognition sequence [ Homo sapiens ]
• Official Symbol: NKTR
• Synonyms: p104
• Gene ID: 4820
• mRNA Refseq: NM_005385.3
• Protein Refseq: NP_005376.2
• MIM: 161565
• UniProt ID: P30414