Recombinant Human NKTR protein(991-1120 aa), C-His-tagged

• Cat.No.: NKTR-2716H
• Product Overview: Recombinant Human NKTR protein(P30414)(991-1120 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 991-1120 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: KKVKEKLKGKKDKKHKAPKRKQAFHWQPPLEFGEEEEEEIDDKQVTQESKEKKVSENNETIKDNILKTEKSSEEDLSGKHDTVTVSSDLDQFTKDDSKLSISPTALNTEENVACLQNIQHVEESVPNGVE

Gene Information

• Gene Name: NKTR natural killer-tumor recognition sequence [ Homo sapiens ]
• Official Symbol: NKTR
• Synonyms: p104
• Gene ID: 4820
• mRNA Refseq: NM_005385.3
• Protein Refseq: NP_005376.2
• MIM: 161565
• UniProt ID: P30414