Recombinant Human NKIRAS2, His-tagged

• Cat.No.: NKIRAS2-27758TH
• Product Overview: Recombinant fragment, corresponding to amino acids 52-191 of Human NKIRAS2 with N terminal His tag; Predicted MWt 17 kDa.

Specification

• Description: NKIRAS2 (NF-kappa-B inhibitor-interacting Ras-like protein 2) is an atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity. It interacts with the PEST domain of NF-kappa-B inhibitor beta (NFKBIB) decreasing the rate of degradation. It may act by blocking phosphorylation of NFKBIB. There are two different isoforms.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 96 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GVREQVRFYDTRGLRDGAELPRHCFSCTDGYVLVYSTDSR ESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRR VDPDVAQHWAKSEKVKLWEVSVADRRSLLEPFVYLASK MTQPQSKSAFPLSRKNKGSGSLDG
• Protein length: 52-191 a.a.

Gene Information

• Gene Name: NKIRAS2 NFKB inhibitor interacting Ras-like 2 [ Homo sapiens ]
• Official Symbol: NKIRAS2
• Synonyms: NKIRAS2; NFKB inhibitor interacting Ras-like 2; NFKB inhibitor interacting Ras like protein 2; NF-kappa-B inhibitor-interacting Ras-like protein 2; DKFZP434N1526; kappaB Ras2; KBRAS2
• Gene ID: 28511
• mRNA Refseq: NM_001001349
• Protein Refseq: NP_001001349
• MIM: 604497
• Uniprot ID: Q9NYR9
• Chromosome Location: 17q21.31
• Pathway: TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem
• Function: GTP binding; GTPase activity; nucleotide binding