Recombinant Human NKIRAS2 Protein, GST-tagged

• Cat.No.: NKIRAS2-5891H
• Product Overview: Human NKIRAS2 full-length ORF ( AAH07450, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: NKIRAS2 (NFKB Inhibitor Interacting Ras Like 2) is a Protein Coding gene. Among its related pathways are NF-KappaB Family Pathway. GO annotations related to this gene include GTP binding and GTPase activity. An important paralog of this gene is NKIRAS1.
• Molecular Mass: 46.75 kDa
• AA Sequence: MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAELPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NKIRAS2 NFKB inhibitor interacting Ras-like 2 [ Homo sapiens ]
• Official Symbol: NKIRAS2
• Synonyms: NKIRAS2; NFKB inhibitor interacting Ras-like 2; NFKB inhibitor interacting Ras like protein 2; NF-kappa-B inhibitor-interacting Ras-like protein 2; DKFZP434N1526; kappaB Ras2; KBRAS2; kappa B-Ras protein 2; I-kappa-B-interacting Ras-like protein 2; NFKB inhibitor interacting Ras-like protein 2; kappaB-Ras2; MGC74742; DKFZp434N1526
• Gene ID: 28511
• mRNA Refseq: NM_001001349
• Protein Refseq: NP_001001349
• MIM: 604497
• UniProt ID: Q9NYR9