Recombinant Human NFYC Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NFYC-2446H
• Product Overview: NFYC MS Standard C13 and N15-labeled recombinant protein (NP_001136061) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 32.6 kDa
• AA Sequence: MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKRNDIAMAITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMPAGQDLAQPMFIQSANQPSDGQAPQVTGDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NFYC nuclear transcription factor Y subunit gamma [ Homo sapiens (human) ]
• Official Symbol: NFYC
• Synonyms: NFYC; nuclear transcription factor Y, gamma; nuclear transcription factor Y subunit gamma; CBF C; NF YC; transactivator HSM-1; transactivator HSM-1/2; CCAAT binding factor subunit C; transcription factor NF-Y, C subunit; CAAT box DNA-binding protein subunit C; nuclear transcription factor Y subunit C; CCAAT transcription binding factor subunit gamma; histone H1 transcription factor large subunit 2A; HSM; CBFC; HAP5; CBF-C; NF-YC; H1TF2A; FLJ45775; DKFZp667G242
• Gene ID: 4802
• mRNA Refseq: NM_001142589
• Protein Refseq: NP_001136061
• MIM: 605344
• UniProt ID: Q13952