Recombinant Human NFYC

• Cat.No.: NFYC-29920TH
• Product Overview: Recombinant fragment of Human NFYC with N-terminal proprietary tag. Predicted MW 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 100 amino acids
• Description: This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDF
• Sequence Similarities: Belongs to the NFYC/HAP5 subunit family.

Gene Information

• Gene Name: NFYC nuclear transcription factor Y, gamma [ Homo sapiens ]
• Official Symbol: NFYC
• Synonyms: NFYC; nuclear transcription factor Y, gamma; nuclear transcription factor Y subunit gamma; CBF C; NF YC
• Gene ID: 4802
• mRNA Refseq: NM_001142587
• Protein Refseq: NP_001136059
• MIM: 605344
• Uniprot ID: Q13952
• Chromosome Location: 1p32
• Pathway: Activation of Chaperones by ATF6-alpha, organism-specific biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Diabetes pathways, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem
• Function: DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity