Recombinant Human NFASC Protein (1239-1347 aa), His-tagged
Cat.No. : | NFASC-682H |
Product Overview : | Recombinant Human NFASC Protein (1239-1347 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Adhesion. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1239-1347 aa |
Description : | Cell adhesion, ankyrin-binding protein which may be involved in neurite extension, axonal guidance, synaptogenesis, myelination and neuron-glial cell interactions. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 15.9 kDa |
AA Sequence : | KRSRGGKYPVREKKDVPLGPEDPKEEDGSFDYSDEDNKPLQGSQTSLDGTIKQQESDDSLVDYGEGGEGQFNEDGSFIGQYTVKKDKEETEGNESSEATSPVNAIYSLA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | NFASC neurofascin [ Homo sapiens ] |
Official Symbol | NFASC |
Synonyms | NFASC; neurofascin; FLJ46866; KIAA0756; NF; NRCAML; DKFZp686P2250; |
Gene ID | 23114 |
mRNA Refseq | NM_001005388 |
Protein Refseq | NP_001005388 |
MIM | 609145 |
UniProt ID | O94856 |
◆ Recombinant Proteins | ||
NFASC-2687H | Recombinant Human NFASC protein, His-tagged | +Inquiry |
NFASC-682H | Recombinant Human NFASC Protein (1239-1347 aa), His-tagged | +Inquiry |
NFASC-236H | Recombinant Human NFASC, His tagged | +Inquiry |
Nfasc-4386M | Recombinant Mouse Nfasc Protein, Myc/DDK-tagged | +Inquiry |
NFASC-1916H | Recombinant Human NFASC protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFASC-918HCL | Recombinant Human NFASC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NFASC Products
Required fields are marked with *
My Review for All NFASC Products
Required fields are marked with *
0
Inquiry Basket