Recombinant Human NEK1 protein, GST-tagged

Cat.No. : NEK1-301539H
Product Overview : Recombinant Human NEK1 (557-740 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Lys557-Asp740
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : KRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKREILRRLNENLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTD
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name NEK1 NIMA (never in mitosis gene a)-related kinase 1 [ Homo sapiens ]
Official Symbol NEK1
Synonyms NEK1; NIMA (never in mitosis gene a)-related kinase 1; serine/threonine-protein kinase Nek1; KIAA1901; NY REN 55; nimA-related protein kinase 1; protein-serine/threonine kinase; renal carcinoma antigen NY-REN-55; never in mitosis A-related kinase 1; SRPS2; NY-REN-55; MGC138800; DKFZp686D06121; DKFZp686K12169;
Gene ID 4750
mRNA Refseq NM_001199397
Protein Refseq NP_001186326
MIM 604588
UniProt ID Q96PY6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NEK1 Products

Required fields are marked with *

My Review for All NEK1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon