Recombinant Human NEK1 protein, His-tagged
Cat.No. : | NEK1-3124H |
Product Overview : | Recombinant Human NEK1 protein(557-740 aa), fused to His tag, was expressed in E. coli. |
Availability | April 22, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 557-740 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | KRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKREILRRLNENLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTD |
Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NEK1 NIMA (never in mitosis gene a)-related kinase 1 [ Homo sapiens ] |
Official Symbol | NEK1 |
Synonyms | NEK1; NIMA (never in mitosis gene a)-related kinase 1; serine/threonine-protein kinase Nek1; KIAA1901; NY REN 55; nimA-related protein kinase 1; protein-serine/threonine kinase; renal carcinoma antigen NY-REN-55; never in mitosis A-related kinase 1; SRPS2; NY-REN-55; MGC138800; DKFZp686D06121; DKFZp686K12169; |
Gene ID | 4750 |
mRNA Refseq | NM_001199397 |
Protein Refseq | NP_001186326 |
MIM | 604588 |
UniProt ID | Q96PY6 |
◆ Recombinant Proteins | ||
NEK1-705H | Recombinant Human NEK1 | +Inquiry |
NEK1-3124H | Recombinant Human NEK1 protein, His-tagged | +Inquiry |
NEK1-3610H | Recombinant Human NEK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NEK1-9928H | Active Recombinant Human NEK1 Protein, GST-tagged | +Inquiry |
NEK1-2993H | Active Recombinant Human NEK1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NEK1 Products
Required fields are marked with *
My Review for All NEK1 Products
Required fields are marked with *
0
Inquiry Basket