Recombinant Human NEK1 protein, His-tagged

• Cat.No.: NEK1-3124H
• Product Overview: Recombinant Human NEK1 protein(557-740 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 557-740 aa
• AA Sequence: KRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKREILRRLNENLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTD
• Purity: 98%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: NEK1 NIMA (never in mitosis gene a)-related kinase 1 [ Homo sapiens ]
• Official Symbol: NEK1
• Synonyms: NEK1; NIMA (never in mitosis gene a)-related kinase 1; serine/threonine-protein kinase Nek1; KIAA1901; NY REN 55; nimA-related protein kinase 1; protein-serine/threonine kinase; renal carcinoma antigen NY-REN-55; never in mitosis A-related kinase 1; SRPS2; NY-REN-55; MGC138800; DKFZp686D06121; DKFZp686K12169
• Gene ID: 4750
• mRNA Refseq: NM_001199397
• Protein Refseq: NP_001186326
• MIM: 604588
• UniProt ID: Q96PY6