Recombinant Human NEK1

• Cat.No.: NEK1-29277TH
• Product Overview: Recombinant fragment of Human NEK1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: The protein encoded by this gene is a serine/threonine kinase involved in cell cycle regulation. The encoded protein is found in a centrosomal complex with FEZ1, a neuronal protein that plays a role in axonal development. Defects in this gene are a cause of polycystic kidney disease (PKD). Several transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: High fetal expression in the brain and kidney.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DVDKSVQPEPFFHKVVHSEHLNLVPQVQSVQCSPEESFAFRSHSHLPPKNKNKNSLLIGLSTGLFDANNPKMLRTCSLPDLSKLFRTLMDVPTVGDVRQD
• Sequence Similarities: Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.Contains 1 protein kinase domain.

Gene Information

• Gene Name: NEK1 NIMA (never in mitosis gene a)-related kinase 1 [ Homo sapiens ]
• Official Symbol: NEK1
• Synonyms: NEK1; NIMA (never in mitosis gene a)-related kinase 1; serine/threonine-protein kinase Nek1; KIAA1901; NY REN 55
• Gene ID: 4750
• mRNA Refseq: NM_001199397
• Protein Refseq: NP_001186326
• MIM: 604588
• Uniprot ID: Q96PY6
• Chromosome Location: 4q32.3
• Function: ATP binding; metal ion binding; nucleotide binding; protein binding; protein kinase activity