Recombinant Human NDUFS4 protein, GST-tagged

• Cat.No.: NDUFS4-301403H
• Product Overview: Recombinant Human NDUFS4 (115-175 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: Ala115-Lys175
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: ASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: NDUFS4 NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase) [ Homo sapiens ]
• Official Symbol: NDUFS4
• Synonyms: NDUFS4; NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase); NADH dehydrogenase (ubiquinone) Fe S protein 4 (18kD) (NADH coenzyme Q reductase); NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial; AQDQ; CI 18; complex I 18kDa subunit; CI-AQDQ; CI-18 kDa; complex I-AQDQ; complex I-18 kDa; NADH-coenzyme Q reductase, 18-KD; NADH-ubiquinone oxidoreductase 18 kDa subunit; NADH dehydrogenase (ubiquinone) iron-sulfur protein 4; mitochondrial respiratory chain complex I (18-KD subunit); CI-18
• Gene ID: 4724
• mRNA Refseq: NM_002495
• Protein Refseq: NP_002486
• MIM: 602694
• UniProt ID: O43181