Recombinant Human NCK2, His-tagged

Cat.No. : NCK2-29113TH
Product Overview : Recombinant fragment, corresponding to amino acids 199-380 of Human Nck beta with an N terminal His tag. Predicted mwt: 22 kDa:
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 199-380 a.a.
Description : This gene encodes a member of the NCK family of adaptor proteins. The protein contains three SH3 domains and one SH2 domain. The protein has no known catalytic function but has been shown to bind and recruit various proteins involved in the regulation of receptor protein tyrosine kinases. It is through these regulatory activities that this protein is believed to be involved in cytoskeletal reorganization. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Conjugation : HIS
Tissue specificity : Ubiquitous.
Form : Lyophilised:Reconstitute with 82 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCK NARGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSS SGRFAGREWYYGNVTRHQAECALNERGVEGDFLIRDSE SSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDE LVEHYKKAPIFTSEHGEKLYLVRALQ
Sequence Similarities : Contains 1 SH2 domain.Contains 3 SH3 domains.
Gene Name NCK2 NCK adaptor protein 2 [ Homo sapiens ]
Official Symbol NCK2
Synonyms NCK2; NCK adaptor protein 2; cytoplasmic protein NCK2; NCKbeta;
Gene ID 8440
mRNA Refseq NM_001004720
Protein Refseq NP_001004720
MIM 604930
Uniprot ID O43639
Chromosome Location 2q12
Pathway Activation of Rac, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem;
Function cytoskeletal adaptor activity; protein binding; receptor signaling complex scaffold activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NCK2 Products

Required fields are marked with *

My Review for All NCK2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon