Recombinant Human NAT6 protein, T7-tagged
Cat.No. : | NAT6-163H |
Product Overview : | Recombinant human NAT6 (308 aa, Isoform_1) protein fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 308 a.a. |
Form : | 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGEFMQELTLSPGPAKLTPTLDPTHRMELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGP TELTLDPEHQPEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPT LEAAPVVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGY QLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGPKGPPLPPPPPLPECLTISPPVPSGPPS KSLLETQYQNVRGRPIFWMEKDI |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | NAT6 N-acetyltransferase 6 (GCN5-related) [ Homo sapiens ] |
Official Symbol | NAT6 |
Synonyms | NAT6; N-acetyltransferase 6 (GCN5-related); N acetyltransferase 6; N-acetyltransferase 6; FUS2; protein fusion-2; FUS-2; |
Gene ID | 24142 |
mRNA Refseq | NM_001200016 |
Protein Refseq | NP_001186945 |
MIM | 607073 |
UniProt ID | Q93015 |
Chromosome Location | 3p21.3 |
Function | N-acetyltransferase activity; transferase activity, transferring acyl groups; |
◆ Recombinant Proteins | ||
NAT6-27229TH | Recombinant Human NAT6, His-tagged | +Inquiry |
NAT6-132H | Recombinant Human N-acetyltransferase 6, His-tagged | +Inquiry |
NAT6-163H | Recombinant Human NAT6 protein, T7-tagged | +Inquiry |
NAT6-827H | Recombinant Human NAT6, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAT6-3963HCL | Recombinant Human NAT6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NAT6 Products
Required fields are marked with *
My Review for All NAT6 Products
Required fields are marked with *
0
Inquiry Basket