Recombinant Human MYO6 Protein, GST-tagged
Cat.No. : | MYO6-5843H |
Product Overview : | Human MYO6 partial ORF ( NP_004990.2, 1188 a.a. - 1285 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein involved intracellular vesicle and organelle transport, especially in the hair cell of the inner ear. Mutations in this gene have been found in patients with non-syndromic autosomal dominant and recessive hearing loss. [provided by RefSeq |
Molecular Mass : | 36.52 kDa |
AA Sequence : | KKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQNAIESRQARPTYATAMLQSLLK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYO6 myosin VI [ Homo sapiens ] |
Official Symbol | MYO6 |
Synonyms | MYO6; myosin VI; deafness, autosomal recessive 37 , DFNA22, DFNB37; unconventional myosin-VI; KIAA0389; myosin-VI; unconventional myosin-6; DFNA22; DFNB37; |
Gene ID | 4646 |
mRNA Refseq | NM_004999 |
Protein Refseq | NP_004990 |
MIM | 600970 |
UniProt ID | Q9UM54 |
◆ Recombinant Proteins | ||
MYO6-5843H | Recombinant Human MYO6 Protein, GST-tagged | +Inquiry |
MYO6-4814H | Recombinant Human MYO6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MYO6-502H | Recombinant Human MYO6 | +Inquiry |
MYO6-3372H | Recombinant Human MYO6 protein, His-tagged | +Inquiry |
MYO6-2927R | Recombinant Rhesus monkey MYO6 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYO6-4006HCL | Recombinant Human MYO6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYO6 Products
Required fields are marked with *
My Review for All MYO6 Products
Required fields are marked with *
0
Inquiry Basket