Recombinant Human MYO6 Protein, GST-tagged

• Cat.No.: MYO6-5843H
• Product Overview: Human MYO6 partial ORF ( NP_004990.2, 1188 a.a. - 1285 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein involved intracellular vesicle and organelle transport, especially in the hair cell of the inner ear. Mutations in this gene have been found in patients with non-syndromic autosomal dominant and recessive hearing loss. [provided by RefSeq
• Molecular Mass: 36.52 kDa
• AA Sequence: KKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQNAIESRQARPTYATAMLQSLLK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYO6 myosin VI [ Homo sapiens ]
• Official Symbol: MYO6
• Synonyms: MYO6; myosin VI; deafness, autosomal recessive 37 , DFNA22, DFNB37; unconventional myosin-VI; KIAA0389; myosin-VI; unconventional myosin-6; DFNA22; DFNB37
• Gene ID: 4646
• mRNA Refseq: NM_004999
• Protein Refseq: NP_004990
• MIM: 600970
• UniProt ID: Q9UM54