Recombinant Human MYO6 protein, His-tagged

• Cat.No.: MYO6-3372H
• Product Overview: Recombinant Human MYO6 protein(1-145 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 1-145 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSEAIKSYQGKSLGTRPPHVFAIADKAFRDMKVLKMSQ
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: MYO6 myosin VI [ Homo sapiens ]
• Official Symbol: MYO6
• Synonyms: MYO6; myosin VI; deafness, autosomal recessive 37 , DFNA22, DFNB37; unconventional myosin-VI; KIAA0389; myosin-VI; unconventional myosin-6; DFNA22; DFNB37
• Gene ID: 4646
• mRNA Refseq: NM_004999
• Protein Refseq: NP_004990
• MIM: 600970
• UniProt ID: Q9UM54