Recombinant Human MYLK3 Protein, GST-tagged

• Cat.No.: MYLK3-5382H
• Product Overview: Human MLCK partial ORF ( NP_872299.1, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Phosphorylation of cardiac myosin heavy chains (see MYH7B, MIM 609928) and light chains (see MYL2, MIM 160781) by a kinase, such as MYLK3, potentiates the force and rate of cross-bridge recruitment in cardiac myocytes (Chan et al., 2008 [PubMed 18202317]).[supplied by OMIM
• Molecular Mass: 36.74 kDa
• AA Sequence: MDTKLNMLNEKVDQLLHFQEDVTEKLQSMCRDMGHLERGLHRLEASRAPGPGGADGVPHIDTQAGWPEVLELVRAMQQDAAQHGARLEALFRMVAAVDRA
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYLK3 myosin light chain kinase 3 [ Homo sapiens ]
• Official Symbol: MYLK3
• Synonyms: MYLK3; myosin light chain kinase 3; putative myosin light chain kinase 3; caMLCK; MLC kinase; MLCK; cardiac-MyBP-C associated Ca/CaM kinase; cardiac-MyBP-C-associated Ca/CaM kinase; MLCK2; MGC126319; MGC126320
• Gene ID: 91807
• mRNA Refseq: NM_182493
• Protein Refseq: NP_872299
• MIM: 612147
• UniProt ID: Q32MK0