Recombinant Human MYH3

• Cat.No.: MYH3-29215TH
• Product Overview: Recombinant fragment corresponding to amino acids 2-100 of Human heavy chain Myosin with an N terminal proprietary tag; Predicted MWt 36.52 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 99 amino acids
• Description: Myosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP. Myosin is a hexameric protein composed of a pair of myosin heavy chains (MYH) and two pairs of nonidentical light chains. This gene is a member of the MYH family and encodes a protein with an IQ domain and a myosin head-like domain. Mutations in this gene have been associated with two congenital contracture (arthrogryposis) syndromes, Freeman-Sheldon syndrome and Sheldon-Hall syndrome.
• Molecular Weight: 36.520kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SSDTEMEVFGIAAPFLRKSEKERIEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAMLTHLNEP
• Sequence Similarities: Contains 1 IQ domain.Contains 1 myosin head-like domain.

Gene Information

• Gene Name: MYH3 myosin, heavy chain 3, skeletal muscle, embryonic [ Homo sapiens ]
• Official Symbol: MYH3
• Synonyms: MYH3; myosin, heavy chain 3, skeletal muscle, embryonic; myosin, heavy polypeptide 3, skeletal muscle, embryonic; myosin-3; HEMHC; muscle embryonic myosin heavy chain 3; MYHC EMB; MYHSE1; myosin; skeletal; heavy chain; embryonic 1; SMHCE
• Gene ID: 4621
• mRNA Refseq: NM_002470
• Protein Refseq: NP_002461
• MIM: 160720
• Uniprot ID: P11055
• Chromosome Location: 17pter-p11
• Pathway: Muscle contraction, organism-specific biosystem; Striated Muscle Contraction, organism-specific biosystem; Striated Muscle Contraction, organism-specific biosystem; Tight junction, organism-specific biosystem; Tight junction, conserved biosystem
• Function: ATP binding; actin binding; calmodulin binding; microfilament motor activity; nucleotide binding