Recombinant Human MYH3 Protein, GST-tagged

• Cat.No.: MYH3-5804H
• Product Overview: Human MYH3 partial ORF ( NP_002461.1, 2 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Myosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP. Myosin is a hexameric protein composed of a pair of myosin heavy chains (MYH) and two pairs of nonidentical light chains. This gene is a member of the MYH family and encodes a protein with an IQ domain and a myosin head-like domain. Mutations in this gene have been associated with two congenital contracture (arthrogryposis) syndromes, Freeman-Sheldon syndrome and Sheldon-Hall syndrome. [provided by RefSeq
• Molecular Mass: 36.63 kDa
• AA Sequence: SSDTEMEVFGIAAPFLRKSEKERIEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAMLTHLNEP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYH3 myosin, heavy chain 3, skeletal muscle, embryonic [ Homo sapiens ]
• Official Symbol: MYH3
• Synonyms: MYH3; myosin, heavy chain 3, skeletal muscle, embryonic; myosin-3; myosin, skeletal, heavy chain, embryonic 1; myosin heavy chain, fast skeletal muscle, embryonic; myosin, heavy polypeptide 3, skeletal muscle, embryonic; HEMHC; SMHCE; MYHSE1; MYHC-EMB
• Gene ID: 4621
• mRNA Refseq: NM_002470
• Protein Refseq: NP_002461