Recombinant Human MYCL1 protein, His-tagged

• Cat.No.: MYCL1-1127H
• Product Overview: Recombinant Human MYCL1 protein(1-206 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-206 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNPAPAAPCPLGEPKTQACSGSESPSDSGKDLPEPSKRGPPHGWPKLCPCLRSGIGSSQALGPSPPLFG
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: MYCL1
• Synonyms: MYCL1; v-myc myelocytomatosis viral oncogene homolog 1, lung carcinoma derived (avian); MYCL, v myc avian myelocytomatosis viral oncogene homolog 1, lung carcinoma derived; protein L-Myc-1; bHLHe38; l myc protein; LMYC; myc related gene from lung cancer; oncogene lmyc; l-myc-1 proto-oncogene; myc-related gene from lung cancer; class E basic helix-loop-helix protein 38; MYCL
• Gene ID: 4610
• mRNA Refseq: NM_001033081
• Protein Refseq: NP_001028253
• MIM: 164850
• UniProt ID: P12524