Recombinant Full Length Human MYCL1 Protein, GST-tagged

• Cat.No.: MYCL1-6729HF
• Product Overview: Human MYCL1 full-length ORF ( NP_005367.1, 1 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 206 amino acids
• Description: MYCL (MYCL Proto-Oncogene, BHLH Transcription Factor) is a Protein Coding gene. Diseases associated with MYCL include Apocrine Adenosis Of Breast and Lower Lip Cancer. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and protein dimerization activity. An important paralog of this gene is MYCN.
• Molecular Mass: 48.2 kDa
• AA Sequence: MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNPAPAAPCPLGEPKTQACSGSESPSDSGKDLPEPSKRGPPHGWPKLCPCLRSGIGSSQALGPSPPLFG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYCL1 v-myc myelocytomatosis viral oncogene homolog 1, lung carcinoma derived (avian) [ Homo sapiens ]
• Official Symbol: MYCL1
• Synonyms: MYCL1; v-myc myelocytomatosis viral oncogene homolog 1, lung carcinoma derived (avian); MYCL, v myc avian myelocytomatosis viral oncogene homolog 1, lung carcinoma derived; protein L-Myc-1; bHLHe38; l myc protein; LMYC; myc related gene from lung cancer; oncogene lmyc; l-myc-1 proto-oncogene; myc-related gene from lung cancer; class E basic helix-loop-helix protein 38; MYCL
• Gene ID: 4610
• mRNA Refseq: NM_001033081
• Protein Refseq: NP_001028253
• MIM: 164850
• UniProt ID: P12524