Recombinant Human MYBPC3 Protein, His-Tagged

• Cat.No.: MYBPC3-01H
• Product Overview: Recombinant human MYBPC3 protein, His-tagged was expressed in E. coli cell

Specification

• Description: MYBPC3 encodes the cardiac isoform of myosin-binding protein C. Myosin-binding protein C is a myosin-associated protein found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. MYBPC3 is expressed exclusively in heart muscle and is a key regulator of cardiac contraction. Mutations in this gene are a frequent cause of familial hypertrophic cardiomyopathy.
• Source: Escherichia coli
• Species: Human
• Tag: His
• Applications: Western blotting, ELISA
• AA Sequence: MKHHHHHHASMPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAF
• Endotoxin: < 1.0 EU/μg
• Purity: Purity as determined by densitometric image analysis: > 95%
• Storage Buffer: Filtered (0.4 μm) and lyophilized in 20 mM Tris buffer, 50 mM NaCl, pH 7.5
• Reconstitution: Add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.
• Storage: Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.
• Notes: This product is intended for research use only.
• Molecular Mass: 29.6 kDa (calculated)
• Identity: LC-MS/MS

Gene Information

• Gene Name: MYBPC3 myosin binding protein C3 [ Homo sapiens (human) ]
• Official Symbol: MYBPC3
• Synonyms: Cardiac MyBP-C, C-protein, cardiac muscle isoform, MYBPC3, Myosin Binding Protein-C3, cMyC
• Gene ID: 4607
• mRNA Refseq: NM_000256.3
• Protein Refseq: NP_000247.2
• UniProt ID: Q14896
• MIM: 600958