Specification
Gene Information
Related Products
Download

Description :	Growth/differentiation factor 8(Mstn, GDF-8) is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. It is expressed specifically in developing and adult skeletal muscle. It exists as a homodimer, and interacts with WFIKKN2, leading to inhibit its activity. This protein can act specifically as a negative regulator of skeletal muscle growth. It regulates cell growth and differentiation in both embryonic and adult tissues.
Source :	HEK293
Species :	Human
Form :	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
AA Sequence :	KRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHL VHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Endotoxin :	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity :	Greater than 95% as determined by reducing SDS-PAGE.
Storage :	Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution :	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Tag :	Non
Protein length :	262-375 a.a.

Gene Name	MSTN myostatin [ Homo sapiens ]
Official Symbol	MSTN
Synonyms	MSTN; myostatin; GDF8, growth differentiation factor 8; growth/differentiation factor 8; GDF-8; growth differentiation factor 8; GDF8; MSLHP;
Gene ID	2660
mRNA Refseq	NM_005259
Protein Refseq	NP_005250
MIM	601788
UniProt ID	O14793
Chromosome Location	2q32.1
Pathway	Hypertrophy Model, organism-specific biosystem;
Function	cytokine activity; growth factor activity; receptor binding; contributes_to receptor binding;