Recombinant human MSTN, Active, His-tagged

• Cat.No.: MSTN-1563H
• Product Overview: Recombinant human Myostatin is a homodimer polypeptide chain containing 2X 109 amino acids (267 – 375 of O14793 Growth/differentiation factor 8) and 6 aa Histidine-based tag. It as a predicted molecular mass of 26.8 kDa (13.4 kDa under reducing conditions in SDS PAGE)

Specification

• Description: Myostatin belongs to the transforming growth factor beta (TGFBs) superfamily, which includes : TGF-betas, Bone morphogenetic protein (BMPs), Growth differentiation factors (GDFs), Activins and Inhibins. As other members of this superfamily, is synthesized and secreted as a homodimeric prepropeptide that is cleaved by proprotein convertases such as furin, to generate the dimeric N- terminal propeptide and the dimeric C-terminal mature active protein.Myostatin is one of the most important protein that controls myoblast proliferation and it is a potent negative regulator of skeletal muscule mass in many animal species. Several studies have shown that Myostatin could play an important role in cardiac development and physiology.Genetic deletion of Myostatin or in vivo administration of the Myostatin propeptide induces muscle hypertrophy as well as enhanced glucose utilization and insulin sensitivity and a reduction in overall fat mass.
• Source: Human recombinant protein expressed in Nicotiana benthamiana. It is produced by transient expression in non-transgenic plants. This product contains no animal–derived components or impurities. Animal Free product.
• Species: Human
• Tag: His
• Form: Recombinant human Myostatin is lyophilized from a Tris HCl 50mM, Urea 1.5M, PMSF 0.004M and Glycine 50mM Buffer pH 8.0.
• Molecular Mass: 26.8 kDa (13.4 kDa under reducing conditions in SDS PAGE)
• AA Sequence: HHHHHHDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGS AGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
• Endotoxin: < 0.04="" eu/μg="" protein="" (lal="">
• Purity: >97% by SDS-PAGE gel
• Storage: This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended.
• Reconstitution: Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 5 ng/ul. Due to the protein nature, dimmers and multimers may be observed. Optimal concentration should be determined for specific application and cell lines.
• Protein length: 267-375 a.a.

Gene Information

• Gene Name: MSTN myostatin [ Homo sapiens ]
• Official Symbol: MSTN
• Synonyms: MSTN; myostatin; GDF8, growth differentiation factor 8; growth/differentiation factor 8; GDF-8; growth differentiation factor 8; GDF8; MSLHP
• Gene ID: 2660
• mRNA Refseq: NM_005259
• Protein Refseq: NP_005250
• MIM: 601788
• UniProt ID: O14793
• Chromosome Location: 2q32.1
• Pathway: Hypertrophy Model, organism-specific biosystem
• Function: cytokine activity; growth factor activity; receptor binding; contributes_to receptor binding