Description :	This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein negatively regulates skeletal muscle cell proliferation and differentiation. Mutations in this gene are associated with increased skeletal muscle mass in humans and other mammals.
Source :	E. coli
Species :	Human
Form :	20mM Tris-HCl, 200 mM NaCl, pH7.4, 2Mm DTT
Molecular Mass :	~13 kDa
AA Sequence :	DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTLTPKMSPINMLYFNGKEQIIYGKIPAMVVDRCSCG
Purity :	> 95% as determined by SDS-PAGE
Storage :	Short Term Storage (1 week) at +4 centigrade, Long Term Storage(3 months) at -20 centigrade to -80 centigrade. Avoid freeze/thaw cycles.
Concentration :	0.1 mg/ml
Tag :	Non

Gene Name	MSTN myostatin [ Homo sapiens ]
Official Symbol	MSTN
Synonyms	MSTN; myostatin; GDF8, growth differentiation factor 8; growth/differentiation factor 8; GDF-8; growth differentiation factor 8; GDF8; MSLHP;
Gene ID	2660
mRNA Refseq	NM_005259
Protein Refseq	NP_005250
MIM	601788
UniProt ID	O14793
Chromosome Location	2q32.1
Pathway	Hypertrophy Model, organism-specific biosystem;
Function	cytokine activity; growth factor activity; receptor binding; contributes_to receptor binding;