Recombinant Human MRPL48, His-tagged

• Cat.No.: MRPL48-147H
• Product Overview: Recombinant Human 39S Ribosomal Protein L48 Mitochondrial/MRPL48 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser29-Lys212) of Human MRPL48 fused with a polyhistidine tag at the C-terminus.

Specification

• Description: 39S Ribosomal Protein L48 Mitochondrial(MRPL48) localizes to the mitochondrion. Mitochondrial ribosomes consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, Human MRPL48 consists a 28 amino acid transit peptide and a 184 amino acid mature chain. MRPL48 can interact with OXA1L.
• Source: HEK293
• Species: Human
• Tag: His
• AA Sequence: SGEKPIYSVGGILLSISRPYKTKPTHGIGKYKHLIKAEEPKKKKGKVEVRAINLGTDYEYGVLNI HLTAYDMTLAESYAQYVHNLCNSLSIKVEESYAMPTKTIEVLQLQDQGSKMLLDSVLTTHERVVQ ISGLSATFAEIFLEIIQSSLPEGVRLSVKEHTEEDFKGRFKARPELEELLAKLKVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Protein length: 29-212 a.a.

Gene Information

• Gene Name: MRPL48 mitochondrial ribosomal protein L48 [ Homo sapiens ]
• Official Symbol: MRPL48
• Synonyms: MRPL48; mitochondrial ribosomal protein L48; 39S ribosomal protein L48, mitochondrial; CGI 118; L48MT; CGI-118; HSPC290; MRP-L48; FLJ17047; FLJ99260; MGC13323
• Gene ID: 51642
• mRNA Refseq: NM_016055
• Protein Refseq: NP_057139
• MIM: 611853
• UniProt ID: Q96GC5
• Chromosome Location: 11q13.4
• Function: protein binding; structural constituent of ribosome