Recombinant Human MRPL12 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MRPL12-4876H |
Product Overview : | MRPL12 MS Standard C13 and N15-labeled recombinant protein (NP_002940) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein which forms homodimers. In prokaryotic ribosomes, two L7/L12 dimers and one L10 protein form the L8 protein complex. |
Molecular Mass : | 21.3 kDa |
AA Sequence : | MLPAAARPLWGPCLGLRAAAFRLARRQVPCVCAVRHMRSSGHQRCEALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVPMGGVMSGAVPAAAAQEAVEEDIPIAKERTHFTVRLTEAKPVDKVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVLETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MRPL12 mitochondrial ribosomal protein L12 [ Homo sapiens (human) ] |
Official Symbol | MRPL12 |
Synonyms | MRPL12; mitochondrial ribosomal protein L12; RPML12; 39S ribosomal protein L12, mitochondrial; MRPL7; MRPL7/L12; MRP-L12; 5c5-2; L12mt; MRP-L31/34; MGC8610; FLJ60124; |
Gene ID | 6182 |
mRNA Refseq | NM_002949 |
Protein Refseq | NP_002940 |
MIM | 602375 |
UniProt ID | P52815 |
◆ Recombinant Proteins | ||
MRPL12-2833R | Recombinant Rhesus monkey MRPL12 Protein, His-tagged | +Inquiry |
MRPL12-5074H | Recombinant Human MRPL12 Protein (Glu46-Glu198), C-His tagged | +Inquiry |
MRPL12-2454Z | Recombinant Zebrafish MRPL12 | +Inquiry |
MRPL12-10044M | Recombinant Mouse MRPL12 Protein | +Inquiry |
MRPL12-5556H | Recombinant Human MRPL12 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL12-4197HCL | Recombinant Human MRPL12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRPL12 Products
Required fields are marked with *
My Review for All MRPL12 Products
Required fields are marked with *
0
Inquiry Basket