Recombinant Human MPV17 Protein, GST-tagged

• Cat.No.: MPV17-5522H
• Product Overview: Human MPV17 full-length ORF ( NP_002428.1, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a mitochondrial inner membrane protein that is implicated in the metabolism of reactive oxygen species. Mutations in this gene have been associated with the hepatocerebral form of mitochondrial DNA depletion syndrome (MDDS). [provided by RefSeq
• Molecular Mass: 46.1 kDa
• AA Sequence: MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MPV17 MpV17 mitochondrial inner membrane protein [ Homo sapiens ]
• Official Symbol: MPV17
• Synonyms: MPV17; MpV17 mitochondrial inner membrane protein; MpV17 transgene, murine homolog, glomerulosclerosis; protein Mpv17; glomerulosclerosis; SYM1; Mpv17, human homolog of glomerulosclerosis and nephrotic syndrome; MTDPS6
• Gene ID: 4358
• mRNA Refseq: NM_002437
• Protein Refseq: NP_002428
• MIM: 137960
• UniProt ID: P39210