Recombinant Full Length Human MPV17 Protein, GST-tagged
Cat.No. : | MPV17-6335HF |
Product Overview : | Human MPV17 full-length ORF ( NP_002428.1, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 176 amino acids |
Description : | This gene encodes a mitochondrial inner membrane protein that is implicated in the metabolism of reactive oxygen species. Mutations in this gene have been associated with the hepatocerebral form of mitochondrial DNA depletion syndrome (MDDS). [provided by RefSeq |
Molecular Mass : | 46.1 kDa |
AA Sequence : | MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MPV17 MpV17 mitochondrial inner membrane protein [ Homo sapiens ] |
Official Symbol | MPV17 |
Synonyms | MPV17; MpV17 mitochondrial inner membrane protein; MpV17 transgene, murine homolog, glomerulosclerosis; protein Mpv17; glomerulosclerosis; SYM1; Mpv17, human homolog of glomerulosclerosis and nephrotic syndrome; MTDPS6; |
Gene ID | 4358 |
mRNA Refseq | NM_002437 |
Protein Refseq | NP_002428 |
MIM | 137960 |
UniProt ID | P39210 |
◆ Recombinant Proteins | ||
MPV17-5656M | Recombinant Mouse MPV17 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL33637XF | Recombinant Full Length Xenopus Laevis Protein Mpv17(Mpv17) Protein, His-Tagged | +Inquiry |
RFL27848HF | Recombinant Full Length Human Protein Mpv17(Mpv17) Protein, His-Tagged | +Inquiry |
RFL13504DF | Recombinant Full Length Danio Rerio Protein Mpv17(Mpv17) Protein, His-Tagged | +Inquiry |
MPV17-10001M | Recombinant Mouse MPV17 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPV17-4222HCL | Recombinant Human MPV17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPV17 Products
Required fields are marked with *
My Review for All MPV17 Products
Required fields are marked with *
0
Inquiry Basket