Recombinant Human MPV17 Protein (1-176 aa), His-SUMO-tagged

• Cat.No.: MPV17-662H
• Product Overview: Recombinant Human MPV17 Protein (1-176 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-176 aa
• Description: Involved in mitochondria homeostasis. May be involved in the metabolism of reactive oxygen species and control of oxidative phosphorylation and mitochondrial DNA (mtDNA) maintenance.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 35.7 kDa
• AA Sequence: MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: MPV17 MpV17 mitochondrial inner membrane protein [ Homo sapiens ]
• Official Symbol: MPV17
• Synonyms: MPV17; protein Mpv17; glomerulosclerosis; SYM1; MTDPS6
• Gene ID: 4358
• mRNA Refseq: NM_002437
• Protein Refseq: NP_002428
• MIM: 137960
• UniProt ID: P39210