Recombinant Human MOS Protein, GST-tagged
Cat.No. : | MOS-5485H |
Product Overview : | Human MOS full-length ORF ( NP_005363.1, 1 a.a. - 346 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).[supplied by OMIM |
Molecular Mass : | 64.2 kDa |
AA Sequence : | MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATLPRAPRLPRRLAWCSIDWEQVCLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLKYSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLLCFQTPSYPLGGTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLSAAVFEDSLPGQRLGDVIQRCWRPSAAQRPSARLLLVDLTSLKAELG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MOS v-mos Moloney murine sarcoma viral oncogene homolog [ Homo sapiens ] |
Official Symbol | MOS |
Synonyms | MOS; v-mos Moloney murine sarcoma viral oncogene homolog; proto-oncogene serine/threonine-protein kinase mos; c-mos; proto-oncogene c-Mos; oocyte maturation factor mos; oncogene MOS, Moloney murine sarcoma virus; MSV; MGC119962; MGC119963; |
Gene ID | 4342 |
mRNA Refseq | NM_005372 |
Protein Refseq | NP_005363 |
MIM | 190060 |
UniProt ID | P00540 |
◆ Recombinant Proteins | ||
MOS-6314HF | Recombinant Full Length Human MOS Protein, GST-tagged | +Inquiry |
MOS-3161C | Recombinant Chicken MOS | +Inquiry |
MOS-11620Z | Recombinant Zebrafish MOS | +Inquiry |
MOS-5485H | Recombinant Human MOS Protein, GST-tagged | +Inquiry |
MOS-5484H | Active Recombinant Human MOS Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOS-4247HCL | Recombinant Human MOS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MOS Products
Required fields are marked with *
My Review for All MOS Products
Required fields are marked with *
0
Inquiry Basket