Recombinant Human MORF4L2 Protein, GST-tagged

Cat.No. : MORF4L2-5479H
Product Overview : Human MORF4L2 full-length ORF ( NP_036418.1, 1 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MORF4L2 (Mortality Factor 4 Like 2) is a Protein Coding gene. Diseases associated with MORF4L2 include Paraneoplastic Cerebellar Degeneration. Among its related pathways are Chromatin organization. An important paralog of this gene is MORF4L1.
Molecular Mass : 58.7 kDa
AA Sequence : MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MORF4L2 mortality factor 4 like 2 [ Homo sapiens ]
Official Symbol MORF4L2
Synonyms MORF4L2; mortality factor 4 like 2; mortality factor 4-like protein 2; KIAA0026; MORF related gene X; MRGX; MSL3-2 protein; protein MSL3-2; MORF-related gene X protein; transcription factor-like protein MRGX; MORFL2;
Gene ID 9643
mRNA Refseq NM_001142418
Protein Refseq NP_001135890
MIM 300409
UniProt ID Q15014

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MORF4L2 Products

Required fields are marked with *

My Review for All MORF4L2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon