Recombinant Human MORF4L2 Protein, GST-tagged

• Cat.No.: MORF4L2-5479H
• Product Overview: Human MORF4L2 full-length ORF ( NP_036418.1, 1 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MORF4L2 (Mortality Factor 4 Like 2) is a Protein Coding gene. Diseases associated with MORF4L2 include Paraneoplastic Cerebellar Degeneration. Among its related pathways are Chromatin organization. An important paralog of this gene is MORF4L1.
• Molecular Mass: 58.7 kDa
• AA Sequence: MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MORF4L2 mortality factor 4 like 2 [ Homo sapiens ]
• Official Symbol: MORF4L2
• Synonyms: MORF4L2; mortality factor 4 like 2; mortality factor 4-like protein 2; KIAA0026; MORF related gene X; MRGX; MSL3-2 protein; protein MSL3-2; MORF-related gene X protein; transcription factor-like protein MRGX; MORFL2
• Gene ID: 9643
• mRNA Refseq: NM_001142418
• Protein Refseq: NP_001135890
• MIM: 300409
• UniProt ID: Q15014