Recombinant Human MOGAT1 Protein, GST-tagged

• Cat.No.: MOGAT1-5467H
• Product Overview: Human MOGAT1 full-length ORF ( AAI46519.1, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Acyl-CoA: monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids (Yen et al., 2002 [PubMed 12077311]).[supplied by OMIM
• Molecular Mass: 63.69 kDa
• AA Sequence: MKVEFAPLNIQLARRLQTVAVLQWVLSFLTGPMSIGITVMLIIHNYLFLYIPYLMWLYFDWHTPERGGRRSSWIKNWTLWKHFKDYFPIHLIKTQDLDPSHNYIFGFHPHGIMAVGAFGNFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGNISVIVLGGAKESLDAHPGKFTLFIRQRKGFVKIALTHGASLVPVVSFGENELFKQTDNPEGSWIRTVQNKLQKIMGFALPLFHARGVFQYNFGLMTYRKAIHTVVGRPIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MOGAT1 monoacylglycerol O-acyltransferase 1 [ Homo sapiens ]
• Official Symbol: MOGAT1
• Synonyms: MOGAT1; monoacylglycerol O-acyltransferase 1; DGAT2L1, diacylglycerol O acyltransferase 2 like 1; 2-acylglycerol O-acyltransferase 1; DGAT2L; MGAT1; hDC2; diacylglycerol O-acyltransferase 2 like 1; acyl-CoA:monoacylglycerol acyltransferase 1; diacylglycerol O-acyltransferase candidate 2; diacylglycerol acyltransferase 2-like protein 1; DGAT2L1
• Gene ID: 116255
• mRNA Refseq: NM_058165
• Protein Refseq: NP_477513
• MIM: 610268
• UniProt ID: Q96PD6