Recombinant Full Length Human MOGAT1 Protein, GST-tagged

Cat.No. : MOGAT1-6303HF
Product Overview : Human MOGAT1 full-length ORF ( AAI46519.1, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 334 amino acids
Description : Acyl-CoA: monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids (Yen et al., 2002 [PubMed 12077311]).[supplied by OMIM
Molecular Mass : 63.69 kDa
AA Sequence : MKVEFAPLNIQLARRLQTVAVLQWVLSFLTGPMSIGITVMLIIHNYLFLYIPYLMWLYFDWHTPERGGRRSSWIKNWTLWKHFKDYFPIHLIKTQDLDPSHNYIFGFHPHGIMAVGAFGNFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGNISVIVLGGAKESLDAHPGKFTLFIRQRKGFVKIALTHGASLVPVVSFGENELFKQTDNPEGSWIRTVQNKLQKIMGFALPLFHARGVFQYNFGLMTYRKAIHTVVGRPIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MOGAT1 monoacylglycerol O-acyltransferase 1 [ Homo sapiens ]
Official Symbol MOGAT1
Synonyms MOGAT1; monoacylglycerol O-acyltransferase 1; DGAT2L1, diacylglycerol O acyltransferase 2 like 1; 2-acylglycerol O-acyltransferase 1; DGAT2L; MGAT1; hDC2; diacylglycerol O-acyltransferase 2 like 1; acyl-CoA:monoacylglycerol acyltransferase 1; diacylglycerol O-acyltransferase candidate 2; diacylglycerol acyltransferase 2-like protein 1; DGAT2L1;
Gene ID 116255
mRNA Refseq NM_058165
Protein Refseq NP_477513
MIM 610268
UniProt ID Q96PD6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MOGAT1 Products

Required fields are marked with *

My Review for All MOGAT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon