Recombinant Human MOCS3, His-tagged

• Cat.No.: MOCS3-143H
• Product Overview: Recombinant Human Adenylyltransferase and Sulfurtransferase MOCS3/MOCS3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Tyr460) of Human MOCS3 fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• ProteinLength: 1-460 a.a.
• Description: Adenylyltransferase and Sulfurtransferase MOCS3 (MOCS3) is a member of the hesA/moeB/thiF family. MOCS3 contains one Molybdopterin-synthase adenylyltransferase domain and one Molybdopterin-synthase sulfurtransferase domain. MOCS3 plays an important role in 2-thiolation of mcm5S2U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln), MOCS3 is essential for biosynthesis of the molybdenum cofactor. MOCS3 can interact with NFS1, which may act as a sulfur donor for thiocarboxylation reactions.
• AA Sequence: MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSR QLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGE ALAGQAKAFSAAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVL AGRPLVSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEV LKIAAGLGPSYSGSLLLFDALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCR SLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLK EAIWEEKQGTQEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDG TFPQYVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

Gene Information

• Gene Name: MOCS3 molybdenum cofactor synthesis 3 [ Homo sapiens ]
• Official Symbol: MOCS3
• Synonyms: MOCS3; molybdenum cofactor synthesis 3; adenylyltransferase and sulfurtransferase MOCS3; dJ914P20.3; UBA4; ubiquitin activating enzyme E1 homolog (yeast); ubiquitin like modifier activating enzyme 4; MPT synthase sulfurylase; molybdopterin synthase sulfurylase; molybdenum cofactor synthesis protein 3; ubiquitin-like modifier activating enzyme 4; UBA4, ubiquitin-activating enzyme E1 homolog; MGC9252
• Gene ID: 27304
• mRNA Refseq: NM_014484
• Protein Refseq: NP_055299
• MIM: 609277
• UniProt ID: O95396
• Chromosome Location: 20q13.13
• Pathway: Metabolism, organism-specific biosystem; Metabolism of vitamins and cofactors, organism-specific biosystem; Metabolism of water-soluble vitamins and cofactors, organism-specific biosystem; Molybdenum cofactor biosynthesis, organism-specific biosystem; Sulfur relay system, organism-specific biosystem; Sulfur relay system, conserved biosystem; molybdenum cofactor biosynthesis, conserved biosystem
• Function: ATP binding; URM1 activating enzyme activity; metal ion binding; nucleotide binding; nucleotidyltransferase activity; protein binding; sulfurtransferase activity; sulfurtransferase activity; thiosulfate sulfurtransferase activity; transferase activity