Recombinant Full Length Human MOCS3 Protein, GST-tagged

• Cat.No.: MOCS3-6301HF
• Product Overview: Human MOCS3 full-length ORF ( AAH15939, 1 a.a. - 460 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 460 amino acids
• Description: Molybdenum cofactor (MoCo) is necessary for the function of all molybdoenzymes. One of the enzymes required for the biosynthesis of MoCo is molybdopterin synthase (MPT synthase). The protein encoded by this gene adenylates and activates MPT synthase. This gene contains no introns. A pseudogene of this gene is present on chromosome 14. [provided by RefSeq
• Molecular Mass: 76.34 kDa
• AA Sequence: MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSRQLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MOCS3 molybdenum cofactor synthesis 3 [ Homo sapiens ]
• Official Symbol: MOCS3
• Synonyms: MOCS3; molybdenum cofactor synthesis 3; adenylyltransferase and sulfurtransferase MOCS3; dJ914P20.3; UBA4; ubiquitin activating enzyme E1 homolog (yeast); ubiquitin like modifier activating enzyme 4; MPT synthase sulfurylase; molybdopterin synthase sulfurylase; molybdenum cofactor synthesis protein 3; ubiquitin-like modifier activating enzyme 4; UBA4, ubiquitin-activating enzyme E1 homolog; MGC9252
• Gene ID: 27304
• mRNA Refseq: NM_014484
• Protein Refseq: NP_055299
• MIM: 609277
• UniProt ID: O95396