Recombinant Human MOCS3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MOCS3-585H
Product Overview : MOCS3 MS Standard C13 and N15-labeled recombinant protein (NP_055299) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Molybdenum cofactor (MoCo) is necessary for the function of all molybdoenzymes. The protein encoded by this gene adenylates and activates molybdopterin synthase, an enzyme required for biosynthesis of MoCo. This gene contains no introns. A pseudogene of this gene is present on chromosome 14.
Molecular Mass : 49.5 kDa
AA Sequence : MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSRQLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MOCS3 molybdenum cofactor synthesis 3 [ Homo sapiens (human) ]
Official Symbol MOCS3
Synonyms MOCS3; molybdenum cofactor synthesis 3; adenylyltransferase and sulfurtransferase MOCS3; dJ914P20.3; UBA4; ubiquitin activating enzyme E1 homolog (yeast); ubiquitin like modifier activating enzyme 4; MPT synthase sulfurylase; molybdopterin synthase sulfurylase; molybdenum cofactor synthesis protein 3; ubiquitin-like modifier activating enzyme 4; UBA4, ubiquitin-activating enzyme E1 homolog; MGC9252;
Gene ID 27304
mRNA Refseq NM_014484
Protein Refseq NP_055299
MIM 609277
UniProt ID O95396

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MOCS3 Products

Required fields are marked with *

My Review for All MOCS3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon