Recombinant Human MGP protein, T7/His-tagged

• Cat.No.: MGP-164H
• Product Overview: Recombinant human MGP cDNA (20 - 96aa) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• ProteinLength: 20-96 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFYESHESMESYELNPFINRRNANTFISPQQRWRAKVQERIRERSKPV HELNREACDDYRLCERYAMVYGYNAAYNRYF
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.

Gene Information

• Gene Name: MGP matrix Gla protein [ Homo sapiens ]
• Official Symbol: MGP
• Synonyms: MGP; matrix Gla protein; cell growth-inhibiting gene 36 protein; NTI; GIG36; MGLAP
• Gene ID: 4256
• mRNA Refseq: NM_000900
• Protein Refseq: NP_000891
• MIM: 154870
• UniProt ID: P08493
• Chromosome Location: 12p12.3
• Pathway: Endochondral Ossification, organism-specific biosystem; Validated transcriptional targets of AP1 family members Fra1 and Fra2, organism-specific biosystem
• Function: calcium ion binding; calcium-dependent protein binding; extracellular matrix structural constituent; structural constituent of bone