Recombinant Human MFAP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MFAP2-1530H |
Product Overview : | MFAP2 MS Standard C13 and N15-labeled recombinant protein (NP_059453) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for this gene. |
Molecular Mass : | 20.8 kDa |
AA Sequence : | MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MFAP2 microfibrillar-associated protein 2 [ Homo sapiens (human) ] |
Official Symbol | MFAP2 |
Synonyms | MFAP2; microfibrillar-associated protein 2; MAGP; MAGP 1; microfibril-associated glycoprotein 1; MAGP1; MAGP-1; FLJ50901; |
Gene ID | 4237 |
mRNA Refseq | NM_017459 |
Protein Refseq | NP_059453 |
MIM | 156790 |
UniProt ID | P55001 |
◆ Recombinant Proteins | ||
MFAP2-4538H | Recombinant Human MFAP2 Protein (Met1-Cys183), C-His tagged | +Inquiry |
MFAP2-30170TH | Recombinant Human MFAP2 | +Inquiry |
MFAP2-1715H | Recombinant Human MFAP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MFAP2-918H | Recombinant Human MFAP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MFAP2-342H | Recombinant Human microfibrillar-associated protein 2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MFAP2-4352HCL | Recombinant Human MFAP2 293 Cell Lysate | +Inquiry |
MFAP2-4351HCL | Recombinant Human MFAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MFAP2 Products
Required fields are marked with *
My Review for All MFAP2 Products
Required fields are marked with *
0
Inquiry Basket