Recombinant Human MFAP2
Cat.No. : | MFAP2-30170TH |
Product Overview : | Recombinant fragment of Human MAGP1 with N-terminal proprietary tag. Predicted MW 34.76kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 83 amino acids |
Description : | Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for this gene. |
Molecular Weight : | 34.760kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFS |
Sequence Similarities : | Belongs to the MFAP family.Contains 1 SXC (ShKT) domain. |
Gene Name | MFAP2 microfibrillar-associated protein 2 [ Homo sapiens ] |
Official Symbol | MFAP2 |
Synonyms | MFAP2; microfibrillar-associated protein 2; MAGP; MAGP 1; |
Gene ID | 4237 |
mRNA Refseq | NM_001135247 |
Protein Refseq | NP_001128719 |
MIM | 156790 |
Uniprot ID | P55001 |
Chromosome Location | 1p36.1-p35 |
Pathway | Notch signaling pathway, organism-specific biosystem; |
Function | fibrinogen binding; fibronectin binding; |
◆ Recombinant Proteins | ||
MFAP2-4538H | Recombinant Human MFAP2 Protein (Met1-Cys183), C-His tagged | +Inquiry |
MFAP2-4539H | Recombinant Human MFAP2 Protein (Leu6-Val162), His tagged | +Inquiry |
Mfap2-7947M | Recombinant Mouse Mfap2 protein, His & GST-tagged | +Inquiry |
MFAP2-342H | Recombinant Human microfibrillar-associated protein 2, His-tagged | +Inquiry |
MFAP2-3615Z | Recombinant Zebrafish MFAP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MFAP2-4352HCL | Recombinant Human MFAP2 293 Cell Lysate | +Inquiry |
MFAP2-4351HCL | Recombinant Human MFAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MFAP2 Products
Required fields are marked with *
My Review for All MFAP2 Products
Required fields are marked with *
0
Inquiry Basket