Recombinant Human MFAP2
| Cat.No. : | MFAP2-30170TH |
| Product Overview : | Recombinant fragment of Human MAGP1 with N-terminal proprietary tag. Predicted MW 34.76kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for this gene. |
| Protein length : | 83 amino acids |
| Molecular Weight : | 34.760kDa inclusive of tags |
| Source : | Wheat germ |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | PAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFS |
| Sequence Similarities : | Belongs to the MFAP family.Contains 1 SXC (ShKT) domain. |
| Tag : | Non |
| Gene Name | MFAP2 microfibrillar-associated protein 2 [ Homo sapiens ] |
| Official Symbol | MFAP2 |
| Synonyms | MFAP2; microfibrillar-associated protein 2; MAGP; MAGP 1; |
| Gene ID | 4237 |
| mRNA Refseq | NM_001135247 |
| Protein Refseq | NP_001128719 |
| MIM | 156790 |
| Uniprot ID | P55001 |
| Chromosome Location | 1p36.1-p35 |
| Pathway | Notch signaling pathway, organism-specific biosystem; |
| Function | fibrinogen binding; fibronectin binding; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MFAP2 Products
Required fields are marked with *
My Review for All MFAP2 Products
Required fields are marked with *
0
Inquiry Basket
