Recombinant Human MFAP2

• Cat.No.: MFAP2-30170TH
• Product Overview: Recombinant fragment of Human MAGP1 with N-terminal proprietary tag. Predicted MW 34.76kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 83 amino acids
• Description: Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for this gene.
• Molecular Weight: 34.760kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFS
• Sequence Similarities: Belongs to the MFAP family.Contains 1 SXC (ShKT) domain.

Gene Information

• Gene Name: MFAP2 microfibrillar-associated protein 2 [ Homo sapiens ]
• Official Symbol: MFAP2
• Synonyms: MFAP2; microfibrillar-associated protein 2; MAGP; MAGP 1
• Gene ID: 4237
• mRNA Refseq: NM_001135247
• Protein Refseq: NP_001128719
• MIM: 156790
• Uniprot ID: P55001
• Chromosome Location: 1p36.1-p35
• Pathway: Notch signaling pathway, organism-specific biosystem
• Function: fibrinogen binding; fibronectin binding