Recombinant Human MELK Protein, GST-tagged

• Cat.No.: MELK-4447H
• Product Overview: Human MELK partial ORF ( AAH14039, 550 a.a. - 650 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MELK (Maternal Embryonic Leucine Zipper Kinase) is a Protein Coding gene. Among its related pathways are Neuroscience. GO annotations related to this gene include calcium ion binding and protein kinase activity. An important paralog of this gene is SNRK.
• Molecular Mass: 36.85 kDa
• AA Sequence: ARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MELK maternal embryonic leucine zipper kinase [ Homo sapiens ]
• Official Symbol: MELK
• Synonyms: MELK; maternal embryonic leucine zipper kinase; KIAA0175; pEg3 kinase; protein kinase Eg3; protein kinase PK38; tyrosine-protein kinase MELK; HPK38
• Gene ID: 9833
• mRNA Refseq: NM_001256685
• Protein Refseq: NP_001243614
• MIM: 607025
• UniProt ID: Q14680