Recombinant Human MED10 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MED10-3064H
• Product Overview: MED10 MS Standard C13 and N15-labeled recombinant protein (NP_115662) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: MED10 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II.
• Molecular Mass: 15.7 kDa
• AA Sequence: MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MED10 mediator complex subunit 10 [ Homo sapiens (human) ]
• Official Symbol: MED10
• Synonyms: MED10; mediator complex subunit 10; L6; NUT2; TRG20; mediator of RNA polymerase II transcription subunit 10; TRG-17; TRG-20; transformation-related gene 17 protein; transformation-related gene 20 protein
• Gene ID: 84246
• mRNA Refseq: NM_032286
• Protein Refseq: NP_115662
• MIM: 612382
• UniProt ID: Q9BTT4