Recombinant Human MED10 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MED10-3064H |
Product Overview : | MED10 MS Standard C13 and N15-labeled recombinant protein (NP_115662) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | MED10 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II. |
Molecular Mass : | 15.7 kDa |
AA Sequence : | MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MED10 mediator complex subunit 10 [ Homo sapiens (human) ] |
Official Symbol | MED10 |
Synonyms | MED10; mediator complex subunit 10; L6; NUT2; TRG20; mediator of RNA polymerase II transcription subunit 10; TRG-17; TRG-20; transformation-related gene 17 protein; transformation-related gene 20 protein |
Gene ID | 84246 |
mRNA Refseq | NM_032286 |
Protein Refseq | NP_115662 |
MIM | 612382 |
UniProt ID | Q9BTT4 |
◆ Recombinant Proteins | ||
MED10-3064H | Recombinant Human MED10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MED10-2457Z | Recombinant Zebrafish MED10 | +Inquiry |
MED10-2536R | Recombinant Rhesus Macaque MED10 Protein, His (Fc)-Avi-tagged | +Inquiry |
Med10-4012M | Recombinant Mouse Med10 Protein, Myc/DDK-tagged | +Inquiry |
MED10-683C | Recombinant Cynomolgus MED10 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MED10-4393HCL | Recombinant Human MED10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MED10 Products
Required fields are marked with *
My Review for All MED10 Products
Required fields are marked with *
0
Inquiry Basket