Recombinant Human MBTPS1 protein, His-tagged

• Cat.No.: MBTPS1-2960H
• Product Overview: Recombinant Human MBTPS1 protein(187-400 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 187-400 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: RAIPRQVAQTLQADVLWQMGYTGANVRVAVFDTGLSEKHPHFKNVKERTNWTNERTLDDGLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTNNQVSYTSWFLDAFNYAILKKIDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPADQMDVIGVGGIDFEDNIARFSSRGMTTWELPGGYGRMKPDIVTYGAGVRG
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: MBTPS1 membrane-bound transcription factor peptidase, site 1 [ Homo sapiens ]
• Official Symbol: MBTPS1
• Synonyms: MBTPS1; membrane-bound transcription factor peptidase, site 1; membrane bound transcription factor protease, site 1; membrane-bound transcription factor site-1 protease; KIAA0091; PCSK8; S1P; SKI 1; site-1 protease; endopeptidase S1P; subtilisin/kexin isozyme-1; subtilisin/kexin-isozyme 1; membrane-bound transcription factor protease, site 1; SKI-1; MGC138711; MGC138712
• Gene ID: 8720
• mRNA Refseq: NM_003791
• Protein Refseq: NP_003782
• MIM: 603355
• UniProt ID: Q14703