Recombinant Human MBTPS1 Protein (218-414 aa), His-SUMO-tagged
Cat.No. : | MBTPS1-2058H |
Product Overview : | Recombinant Human MBTPS1 Protein (218-414 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 218-414 aa |
Description : | Serine protease that catalyzes the first step in the proteolytic activation of the sterol regulatory element-binding proteins (SREBPs). Other known substrates are BDNF, GNPTAB and ATF6. Cleaves after hydrophobic or small residues, provided that Arg or Lys is in position P4. Cleaves known substrates after Arg-Ser-Val-Leu (SERBP-2), Arg-His-Leu-Leu (ATF6), Arg-Gly-Leu-Thr (BDNF) and its own propeptide after Arg-Arg-Leu-Leu. Mediates the protein cleavage of GNPTAB into subunit alpha and beta, thereby participating in biogenesis of lysosomes. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 37.5 kDa |
AA Sequence : | DTGLSEKHPHFKNVKERTNWTNERTLDDGLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTNNQVSYTSWFLDAFNYAILKKIDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPADQMDVIGVGGIDFEDNIARFSSRGMTTWELPGGYGRMKPDIVTYGAGVRGSGVKGGCRALSGTS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | MBTPS1 membrane-bound transcription factor peptidase, site 1 [ Homo sapiens ] |
Official Symbol | MBTPS1 |
Synonyms | MBTPS1; KIAA0091; PCSK8; S1P; SKI 1; site-1 protease; endopeptidase S1P; SKI-1; MGC138711; MGC138712; |
Gene ID | 8720 |
mRNA Refseq | NM_003791 |
Protein Refseq | NP_003782 |
MIM | 603355 |
UniProt ID | Q14703 |
◆ Recombinant Proteins | ||
MBTPS1-3608R | Recombinant Rat MBTPS1 Protein | +Inquiry |
MBTPS1-29H | Recombinant Human MBTPS1 protein, GST-tagged | +Inquiry |
MBTPS1-9897Z | Recombinant Zebrafish MBTPS1 | +Inquiry |
MBTPS1-9614M | Recombinant Mouse MBTPS1 Protein | +Inquiry |
MBTPS1-3264R | Recombinant Rat MBTPS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MBTPS1-4435HCL | Recombinant Human MBTPS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MBTPS1 Products
Required fields are marked with *
My Review for All MBTPS1 Products
Required fields are marked with *
0
Inquiry Basket