Recombinant Human MB protein(21-100 aa), C-His-tagged
Cat.No. : | MB-2522H |
Product Overview : | Recombinant Human MB protein(P02144)(21-100 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-100 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 11 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | DIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKI |
Gene Name | MB myoglobin [ Homo sapiens ] |
Official Symbol | MB |
Synonyms | MB; myoglobin; PVALB; MGC13548; |
Gene ID | 4151 |
mRNA Refseq | NM_005368 |
Protein Refseq | NP_005359 |
MIM | 160000 |
UniProt ID | P02144 |
◆ Recombinant Proteins | ||
MB-9596M | Recombinant Mouse MB Protein | +Inquiry |
MB-1056H | Recombinant Human Myoglobin Protein | +Inquiry |
Mb-3977M | Recombinant Mouse Mb Protein, Myc/DDK-tagged | +Inquiry |
MB-1768H | Recombinant Human MB Protein, His&GST-tagged | +Inquiry |
MB-5333B | Recombinant Bovine MB protein | +Inquiry |
◆ Native Proteins | ||
Mb-8229M | Native Mouse Myoglobin | +Inquiry |
MB-8226H | Native Human Heart Myoglobin | +Inquiry |
MB-02B | Native Bovine MB Protein | +Inquiry |
Mb-160M | Native Mouse Mb | +Inquiry |
MB-8227H | Native Human Heart Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
MB-4445HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
MB-4446HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MB Products
Required fields are marked with *
My Review for All MB Products
Required fields are marked with *
0
Inquiry Basket