Recombinant Mouse Mb protein, His&Myc-tagged
Cat.No. : | Mb-3210M |
Product Overview : | Recombinant Mouse Mb protein(P04247)(2-154aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2-154aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.9 kDa |
AA Sequence : | GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Mb myoglobin [ Mus musculus ] |
Official Symbol | Mb |
Synonyms | MB; myoglobin; AI325109; |
Gene ID | 17189 |
mRNA Refseq | NM_001164047 |
Protein Refseq | NP_001157519 |
◆ Recombinant Proteins | ||
MB-532C | Recombinant Cynomolgus monkey MB protein, His-tagged | +Inquiry |
MB-2522H | Recombinant Human MB protein(21-100 aa), C-His-tagged | +Inquiry |
Mb-3977M | Recombinant Mouse Mb Protein, Myc/DDK-tagged | +Inquiry |
MB-4506H | Recombinant Human MB Protein (Met1-Gly154), N-GST tagged | +Inquiry |
MB-165H | Recombinant Human Myoglobin, Heme free, T7-tagged | +Inquiry |
◆ Native Proteins | ||
Mb-8232R | Native Rat Myoglobin | +Inquiry |
MB-237C | Native Dog Myoglobin | +Inquiry |
MB-8227H | Native Human Heart Myoglobin | +Inquiry |
MB-238E | Native Horse Myoglobin | +Inquiry |
MB-4460H | Native Human Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
MB-4445HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
MB-4446HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mb Products
Required fields are marked with *
My Review for All Mb Products
Required fields are marked with *
0
Inquiry Basket