Recombinant Human MB protein

• Cat.No.: MB-159H
• Product Overview: Recombinant Human MB protein was expressed in E.coli

Specification

• Description: This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen. At least three alternatively spliced transcript variants encoding the same protein have been reported.
• Source: E.coli
• Species: Human
• Form: Supplied as a 0.2μm filtered solution in 25 mM Tris-HCl, pH 8.0, with 50 % glycerol.
• Molecular Mass: Approximately 17.1 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids.
• Protein length: 153
• AA Sequence: GLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
• Endotoxin: Less than 1.0 EU/μg of rHuMyoglobin as determined by LAL method.
• Purity: >95% by SDS-PAGE.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening.
• Tag: Non

Gene Information

• Gene Name: MB
• Official Symbol: MB
• Synonyms: MB; myoglobin; PVALB; MGC13548
• Gene ID: 4151
• mRNA Refseq: NM_005368
• Protein Refseq: NP_005359
• MIM: 160000
• UniProt ID: P02144